Product Information
14976-1-AP targets SLC25A20 in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6887 Product name: Recombinant human SLC25A20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 96-209 aa of BC001689 Sequence: GKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSA Predict reactive species |
| Full Name | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 |
| Calculated Molecular Weight | 33 kDa |
| GenBank Accession Number | BC001689 |
| Gene Symbol | SLC25A20 |
| Gene ID (NCBI) | 788 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43772 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
