Tested Applications
Positive WB detected in | Saos-2 cells, mouse heart tissue, human testis tissue, mouse skeletal muscle tissue, mouse testis tissue, rat testis tissue |
Positive IHC detected in | mouse heart tissue, human heart tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | Hela cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 11 publications below |
IHC | See 1 publications below |
Product Information
19363-1-AP targets SLC25A20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6896 Product name: Recombinant human SLC25A20 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 96-209 aa of BC001689 Sequence: GKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSA Predict reactive species |
Full Name | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 |
Calculated Molecular Weight | 33 kDa |
Observed Molecular Weight | 33 kDa |
GenBank Accession Number | BC001689 |
Gene Symbol | SLC25A20 |
Gene ID (NCBI) | 788 |
RRID | AB_10642001 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43772 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC25A20 antibody 19363-1-AP | Download protocol |
IHC protocol for SLC25A20 antibody 19363-1-AP | Download protocol |
IF protocol for SLC25A20 antibody 19363-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Enhancement of anaerobic glycolysis - a role of PGC-1α4 in resistance exercise. | ||
Commun Biol Transmembrane protein 135 regulates lipid homeostasis through its role in peroxisomal DHA metabolism | ||
Nutrients The Enhancement of Acylcarnitine Metabolism by 5-Heptadecylresorcinol in Brown Adipose Tissue Contributes to Improving Glucose and Lipid Levels in Aging Male Mice | ||
Sci Rep Targeted Metabolomics Reveals Abnormal Hepatic Energy Metabolism by Depletion of β-Carotene Oxygenase 2 in Mice. | ||
Front Physiol PPARδ Attenuates Alcohol-Mediated Insulin Resistance by Enhancing Fatty Acid-Induced Mitochondrial Uncoupling and Antioxidant Defense in Skeletal Muscle. | ||
Cell Rep Mutant CHCHD10 causes an extensive metabolic rewiring that precedes OXPHOS dysfunction in a murine model of mitochondrial cardiomyopathy. |