SLC25A24 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 14669-1-AP (same clone as 14669-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14669-1-AP (SLC25A24 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14669-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 14669-1-AP (same clone as 14669-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14669-1-AP (SLC25A24 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14669-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 14669-1-AP (same clone as 14669-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 14669-1-AP (SLC25A24 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14669-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14669-1-AP (same clone as 14669-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14669-1-AP (SLC25A24 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14669-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14669-1-AP (same clone as 14669-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14669-1-AP (SLC25A24 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14669-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 14669-1-AP (same clone as 14669-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using 14669-1-AP (SLC25A24 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14669-1-PBS in a different storage buffer formulation.

SLC25A24 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14669-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

APC1, MCSC1, Mitochondrial adenyl nucleotide antiporter SLC25A24, Mitochondrial ATP-Mg/Pi carrier protein 1, Mitochondrial Ca(2+)-dependent solute carrier protein 1

---

Product Information

14669-1-PBS targets SLC25A24 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6334

  Product name: Recombinant human SLC25A24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-477 aa of BC068561

  Sequence: ELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK

• Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC068561
• Gene Symbol: SLC25A24
• Gene ID (NCBI): 29957
• RRID: AB_10637267
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6NUK1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A24 (solute carrier family 25 member 24) is a gene encoding a mitochondrial ATP-Mg/phosphate transporter. It belongs to the mitochondrial carrier protein family and is mainly involved in mitochondrial energy metabolism and calcium signal regulation.