Tested Applications
| Positive WB detected in | C2C12 cells, mouse brain tissue, mouse heart tissue, mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30631-1-AP targets SLC25A4 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33385 Product name: Recombinant human SLC25A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 131-178 aa of BC008664 Sequence: VYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFN Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC008664 |
| Gene Symbol | SLC25A4 |
| Gene ID (NCBI) | 291 |
| RRID | AB_3086377 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P12235 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Adenine nucleotide translocators (ANTs) are mitochondrial carrier proteins that exchange ATP and ADP between the cytoplasm and the mitochondrial matrix. Four isoforms of ANT were identified: ANT1 (encoded by SLC25A4) is highly expressed in different tissues; ANT2 (encoded by SLC25A5) is predominantly expressed in proliferating, regenerating, or undifferentiated cells; ANT3 is ubiquitously expressed; ANT4 is mainly expressed in testis and germ cells. This antibody recognizes both of ANT1 and ANT2.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC25A4 antibody 30631-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

