Tested Applications
Positive IHC detected in | human liver cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
26292-1-AP targets SLC25A47 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23376 Product name: Recombinant human C14orf68 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 117-188 aa of BC137253 Sequence: EVAKVRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLR Predict reactive species |
Full Name | chromosome 14 open reading frame 68 |
GenBank Accession Number | BC137253 |
Gene Symbol | SLC25A47 |
Gene ID (NCBI) | 283600 |
RRID | AB_2880465 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6Q0C1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SLC25A47 antibody 26292-1-AP | Download protocol |
IF protocol for SLC25A47 antibody 26292-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |