SLC25A47 Polyclonal antibody

• 

  IHC staining of human liver cancer using 26292-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26292-1-AP (SLC25A47 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 26292-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26292-1-AP (SLC25A47 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 26292-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26292-1-AP (SLC25A47 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 26292-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26292-1-AP (SLC25A47 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 26292-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26292-1-AP (SLC25A47 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 26292-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 26292-1-AP (SLC25A47 antibody), at dilution of 1:100 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

SLC25A47 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 26292-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

C14orf68, HDMCP, HMFN1655, SLC25A47

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

26292-1-AP targets SLC25A47 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23376

  Product name: Recombinant human C14orf68 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-188 aa of BC137253

  Sequence: EVAKVRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLR

• Full Name: chromosome 14 open reading frame 68
• GenBank Accession Number: BC137253
• Gene Symbol: SLC25A47
• Gene ID (NCBI): 283600
• RRID: AB_2880465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6Q0C1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC,IF	Biomed Pharmacother; Human umbilical cord-derived mesenchymal stem cells ameliorate liver fibrosis by improving mitochondrial function via Slc25a47-Sirt3 signaling pathway; Authors - Ping Chen