Tested Applications
| Positive WB detected in | mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22013-1-AP targets SLC26A5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16631 Product name: Recombinant human SLC26A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC100832 Sequence: MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVS Predict reactive species |
| Full Name | solute carrier family 26, member 5 (prestin) |
| Calculated Molecular Weight | 744 aa, 81 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC100832 |
| Gene Symbol | SLC26A5 |
| Gene ID (NCBI) | 375611 |
| RRID | AB_3669384 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P58743 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC26A5 (Prestin) is a protein that is housed in abundance within the lateral membrane of outer hair cells (OHC) in the organ of Corti. The protein imparts robust electromechanical activity to the cell that is unlike any other form of cellular motility, notably associated with a voltage-dependent, bell-shaped nonlinear capacitance (NLC) that reports on conformational changes in the protein (PMID: 32061780). SLC26A5 is responsible for acute sensitivity and frequency selectivity in the vertebrate auditory system (PMID: 34294052).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC26A5 antibody 22013-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

