SLC26A7 Polyclonal antibody, PBS Only

• 

  WB analysis using 17654-1-AP (same clone as 17654-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17654-1-AP (SLC26A7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17654-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 17654-1-AP (same clone as 17654-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using SLC26A7 antibody (17654-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17654-1-PBS in a different storage buffer formulation.

SLC26A7 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17654-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

SUT2

---

Product Information

17654-1-PBS targets SLC26A7 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11901

  Product name: Recombinant human SLC26A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 465-656 aa of BC094730

  Sequence: IAIVIGRFPRAMTVSIKNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDISKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV

• Full Name: solute carrier family 26, member 7
• Calculated Molecular Weight: 656 aa, 72 kDa
• Observed Molecular Weight: 85-100 kDa
• GenBank Accession Number: BC094730
• Gene Symbol: SLC26A7
• Gene ID (NCBI): 115111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TE54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC26A7, Anion exchange transporter, belongs to sulfate/anion transporter family. SLC26A7 acts as a sodium-independent DIDS-sensitive anion exchanger mediating bicarbonate, chloride, sulfate and oxalate transport. It plays a role in the maintenance of the electrolyte and acid-base homeostasis in the kidney, by acting as a distal excretory segment-specific anion exchanger (PMID: 11834742, PMID: 12736153). SLC26A7 mutations is associated with thyroid dyshormonogenesis (PMID:29546359).