SLC26A7 Polyclonal antibody

• 

  WB analysis using 17654-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17654-1-AP (SLC26A7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17654-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17654-1-AP (SLC26A7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SLC26A7 Polyclonal Antibody for WB, ELISA

Cat No. 17654-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Anion exchange transporter, SLC26A7, SUT2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse kidney tissue, mouse testis tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17654-1-AP targets SLC26A7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11901

  Product name: Recombinant human SLC26A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 465-656 aa of BC094730

  Sequence: IAIVIGRFPRAMTVSIKNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDISKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV

• Full Name: solute carrier family 26, member 7
• Calculated Molecular Weight: 656 aa, 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC094730
• Gene Symbol: SLC26A7
• Gene ID (NCBI): 115111
• RRID: AB_3085530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TE54
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC26A7, Anion exchange transporter, belongs to sulfate/anion transporter family. SLC26A7 acts as a sodium-independent DIDS-sensitive anion exchanger mediating bicarbonate, chloride, sulfate and oxalate transport. It plays a role in the maintenance of the electrolyte and acid-base homeostasis in the kidney, by acting as a distal excretory segment-specific anion exchanger (PMID: 11834742, PMID: 12736153). SLC26A7 mutations is associated with thyroid dyshormonogenesis (PMID:29546359).