Tested Applications
| Positive WB detected in | mouse stomach tissue |
| Positive IP detected in | BxPC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33108-1-AP targets SLC26A9 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37313 Product name: Recombinant human SLC26A9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-70 aa of BC151208 Sequence: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPNYKIKDY Predict reactive species |
| Full Name | solute carrier family 26, member 9 |
| Calculated Molecular Weight | 791 aa, 87 kDa |
| Observed Molecular Weight | 100-115 kDa |
| GenBank Accession Number | BC151208 |
| Gene Symbol | SLC26A9 |
| Gene ID (NCBI) | 115019 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q7LBE3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Solute carrier family 26 member 9 (SLC26A9) is one out of 11 proteins that belong to the SLC26A family of anion transporters. Apart from expression in the gastrointestinal tract, SLC26A9 is also found in the respiratory system, in male tissues and in the skin. SLC26A9 has gained attention because of its modifier role in the gastrointestinal manifestation of cystic fibrosis (CF). SLC26A9 appears to have an impact on the extent of intestinal obstruction caused by meconium ileus. SLC26A9 supports duodenal bicarbonate secretion, but was assumed to provide a basal Cl- secretory pathway in airways. (PMID: 36866602). SLC26A9 was shown to be located at the luminal side of lung bronchiolar and alveolar epithelium (PMID: 11834742).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for SLC26A9 antibody 33108-1-AP | Download protocol |
| WB protocol for SLC26A9 antibody 33108-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



