Product Information
17828-1-AP targets SLC2A11 in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12210 Product name: Recombinant human SLC2A11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 219-317 aa of BC094735 Sequence: SPRYLLIDCGDTEACLAALRQLRGSGDLAGELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYASSVFRKAGVPEAKI Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 11 |
| Calculated Molecular Weight | 503 aa, 54 kDa |
| GenBank Accession Number | BC094735 |
| Gene Symbol | SLC2A11 |
| Gene ID (NCBI) | 66035 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYW1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
