Recombinant human SLC2A3 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag14203
Synonyms
GLUT 3, SLC2A3, GLUT3, GLUT-3, SLC
Validation Data Gallery View All
Product Information
| Peptide Sequence |
ESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQ
(207-281 aa encoded by BC039196) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
