SLC2A6 Fusion Protein

Catalog number: Ag18707

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

SLC2A6 fusion protein Ag18707 SDS-PAGE


Product Name:
human SLC2A6-6*His fusion protein

Catalog No:
Ag18707

Source:
E. coli-derived, PET28a

Peptide Sequence:
LSFMPNSPRFLLSRGRDEEALRALAWLRGTDVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTG
(211-290 aa encoded by BC013740)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top