SLC2A9 Polyclonal antibody

• 

  WB analysis of mouse liver using 26486-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26486-1-AP (SLC2A9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 26486-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26486-1-AP (SLC2A9 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 26486-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26486-1-AP (SLC2A9 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human hepatocirrhosis using 26486-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 26486-1-AP (SLC2A9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 26486-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 26486-1-AP (SLC2A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC2A9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26486-1-AP

Publications(58)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Urate transporter, GLUTX, GLUT-9, GLUT9

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: human liver tissue, human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 50 publications below
• IHC: See 7 publications below
• IF: See 4 publications below

Product Information

26486-1-AP targets SLC2A9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24135

  Product name: Recombinant human SLC2A9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 443-511 aa of BC018897

  Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP

• Full Name: solute carrier family 2 (facilitated glucose transporter), member 9
• Calculated Molecular Weight: 540 aa, 59 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC018897
• Gene Symbol: SLC2A9
• Gene ID (NCBI): 56606
• RRID: AB_2880532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRM0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Phytomedicine; Identifying the natural compounds in Jinqian Xuduan Decoction for simultaneous uric acid lowering and chronic kidney disease amelioration; Authors - Hanfei Wang
mouse	WB	Phytomedicine; Amelioration effects of α-viniferin on hyperuricemia and hyperuricemia-induced kidney injury in mice; Authors - Xiao-Li Guo
	WB	Elife; Host-derived Lactobacillus plantarum alleviates hyperuricemia by improving gut microbial community and hydrolase-mediated degradation of purine nucleosides; Authors - Yang Fu
mouse	IHC	Food Funct; Anti-hyperuricemic potential of stevia (Stevia rebaudiana Bertoni) residue extract in hyperuricemic mice; Authors - Arshad Mehmood
rat	WB	Food Funct; Ferulic acid supplementation alleviates hyperuricemia in high-fructose/fat diet-fed rats via promoting uric acid excretion and mediating the gut microbiota; Authors - Nanhai Zhang
mouse	WB	Nutrients; Chinese Sumac (Rhus chinensis Mill.) Fruits Prevent Hyperuricemia and Uric Acid Nephropathy in Mice Fed a High-Purine Yeast Diet; Authors - Nan Ma