Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ZnT6 Polyclonal antibody

ZnT6 Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, ELISA

MST103, MSTP103, SLC30A6, Zinc transporter 6, ZnT 6, ZNT6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ZnT6 in ?

Tested Applications

Positive WB detected inA375 cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13526-1-AP targets ZnT6 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, chicken, yellow catfish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4403

Product name: Recombinant human SLC30A6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 286-501 aa of BC032525

Sequence: MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP

Predict reactive species
Full Name solute carrier family 30 (zinc transporter), member 6
Calculated Molecular Weight 460 aa, 50 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC032525
Gene Symbol ZnT6
Gene ID (NCBI) 55676
RRIDAB_2254797
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6NXT4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZnT6 (encoded by SLC30A6) is a member of zinc transporters. ZnT6 is localized on the membrane of the Golgi apparatus as well as cytoplasmic vesicles. It may function in transporting the cytoplasmic zinc into the Golgi apparatus as well as the vesicular compartment. Altered expression of ZnT6 may correlate to neural diseases including Alzheimer's disease. Several isoforms of ZnT6 exist due to the alternative splicing, with MW around 48-56 kDa.

Protocols

Product Specific Protocols
WB protocol for ZnT6 antibody 13526-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ZnT6 Polyclonal antibody (Cat# 13526-1-AP) has 8 total citations. These appear in journals including J Biol Chem, Acta Neuropathol Commun, J Neurosci Res, Biochim Biophys Acta Gene Regul Mech, J Trace Elem Med Biol, Metallomics, and Biol Open. The associated research fields encompass zinc transporter biology and biometal homeostasis, neurodegenerative diseases (including ALS and neuronal ceroid lipofuscinosis), the secretory pathway, and oxidative stress responses. All cited applications are Western blot.

SpeciesApplicationTitle
mouseWB

Acta Neuropathol Commun

Deregulation of subcellular biometal homeostasis through loss of the metal transporter, Zip7, in a childhood neurodegenerative disorder.

Authors - Alexandra Grubman
humanWB

J Biol Chem

Tissue nonspecific alkaline phosphatase is activated via a two-step mechanism by zinc transport complexes in the early secretory pathway.

Authors - Fukunaka Ayako A
chickenWB

J Biol Chem

Detailed analyses of the crucial functions of Zn transporter proteins in alkaline phosphatase activation.

Authors - Eisuke Suzuki
  • KO Validated
mouseWB

J Trace Elem Med Biol

Ginsenoside Rb1 combined with Lycium barbarum polysaccharide alleviate the Tripterygium wilfordii polyglycoside-induced oligoasthenozoospermia in mice by inhibiting ZnT3-mediated oxidative stress response

Authors - Xianrui Li
Yellow catfishWB

Biochim Biophys Acta Gene Regul Mech

Transcriptional responses of four slc30a/znt family members and their roles in Zn homeostatic modulation in yellow catfish Pelteobagrus fulvidraco.

Authors - Chang-Chun Song
human, mouseWB

J Neurosci Res

Zinc transporters ZnT3 and ZnT6 are downregulated in the spinal cords of patients with sporadic amyotrophic lateral sclerosis.

Authors - Masayuki Kaneko
Loading...
||
New chat

Able™

正在加载,请稍候...