• Featured Product
  • KD/KO Validated

SLC31A1 Polyclonal antibody

SLC31A1 Polyclonal Antibody for WB, IF-P, FC, ELISA
Cat No. 27499-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC, ELISA

COPT1, CTR1, Truncated CTR1 form

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, Caco-2 cells, HeLa cells
Positive IF-P detected inhuman liver cancer tissue
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27499-1-AP targets SLC31A1 in WB, IHC, IF-P, FC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26601

Product name: Recombinant human SLC31A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-67 aa of BC013611

Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG

Predict reactive species
Full Name solute carrier family 31 (copper transporters), member 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight21-25,30-35,60-70 kDa
GenBank Accession NumberBC013611
Gene Symbol SLC31A1
Gene ID (NCBI) 1317
RRIDAB_2918124
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15431
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC31A1, also known as CTR1, COPT1 and solute carrier family 31 member 1, is a high-affinity copper transporter found in the cell membrane of human cells. It plays a crucial role in maintaining copper homeostasis within the body and functions as a homotrimer to influence dietary copper absorption in the cell membrane (PMID: 37853210; 28507097). SLC31A1 has three putative transmembrane domains, with an N-terminus located extracellularly and a C-terminus located intracellularly (PMID: 12827356). SLC31A1 can be detected a a 28 kDa band corresponding to glycosylated hCTR1 monomer, and a 24 kDa band that is unglycosylated hCTR1. In some membrane preparations a C-terminal degradation product of 17 kDa is also seen (PMID: 16135512). Additionally, SLC31A1 may also resolve as a 30 to 35 kDa and a 60 to 70 kDa protein on immunoblots, forming oligomers corresponding to the expected size of a homotrimeric complex (PMID: 12827356).

Protocols

Product Specific Protocols
FC protocol for SLC31A1 antibody 27499-1-APDownload protocol
IF protocol for SLC31A1 antibody 27499-1-APDownload protocol
WB protocol for SLC31A1 antibody 27499-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Int J Mol Sci

Transcriptional Responses of Copper-Transport-Related Genes ctr1, ctr2 and atox1 and Their Roles in the Regulation of Cu Homeostasis in Yellow Catfish Pelteobagrus fulvidraco

Authors - Hong Yang
humanWB

Cancer Res Commun

Targeting NEDDylation is a Novel Strategy to Attenuate Cisplatin-induced Nephrotoxicity

Authors - Trace M Jones
mouseIF

Gene

The STAT1-SLC31A1 axis: Potential regulation of cuproptosis in diabetic retinopathy

Authors - Qiang Hu
humanWB,IHC

J Assist Reprod Genet

Blocking lactate regulation of the Grhl2/SLC31A1 axis inhibits trophoblast cuproptosis and preeclampsia development

Authors - Xue-Yan Shen
mouseIF

Life Sci

Metallothionein rescues doxorubicin cardiomyopathy via mitigation of cuproptosis

Authors - Yan Liu
mouseWB

J Hazard Mater

Cu(OH)2 nanopesticide induced liver dysfunction in mice by targeting lipoylated tricarboxylic acid cycle proteins via ferredoxin 1

Authors - Zhihua Ren
Loading...
||
New chat Able
正在加载,请稍候...