Tested Applications
| Positive WB detected in | HT-29 cells, Caco-2 cells, HeLa cells |
| Positive IF-P detected in | human liver cancer tissue |
| Positive FC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) | FC : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
27499-1-AP targets SLC31A1 in WB, IHC, IF-P, FC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species |
| Full Name | solute carrier family 31 (copper transporters), member 1 |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21-25,30-35,60-70 kDa |
| GenBank Accession Number | BC013611 |
| Gene Symbol | SLC31A1 |
| Gene ID (NCBI) | 1317 |
| RRID | AB_2918124 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15431 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC31A1, also known as CTR1, COPT1 and solute carrier family 31 member 1, is a high-affinity copper transporter found in the cell membrane of human cells. It plays a crucial role in maintaining copper homeostasis within the body and functions as a homotrimer to influence dietary copper absorption in the cell membrane (PMID: 37853210; 28507097). SLC31A1 has three putative transmembrane domains, with an N-terminus located extracellularly and a C-terminus located intracellularly (PMID: 12827356). SLC31A1 can be detected a a 28 kDa band corresponding to glycosylated hCTR1 monomer, and a 24 kDa band that is unglycosylated hCTR1. In some membrane preparations a C-terminal degradation product of 17 kDa is also seen (PMID: 16135512). Additionally, SLC31A1 may also resolve as a 30 to 35 kDa and a 60 to 70 kDa protein on immunoblots, forming oligomers corresponding to the expected size of a homotrimeric complex (PMID: 12827356).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SLC31A1 antibody 27499-1-AP | Download protocol |
| IF protocol for SLC31A1 antibody 27499-1-AP | Download protocol |
| WB protocol for SLC31A1 antibody 27499-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Curr Med Sci Dapagliflozin Suppressed Cuproptosis and Myocardial Fibrosis in Myocardial Infarction Through HIF-1α/TGF-β Pathway | ||
Mol Cell RAD23B acquires a copper metalloadaptor function in amphibian-to-reptile evolution to increase metabolism and regulate genomic integrity | ||
Cancer Res Commun Targeting NEDDylation is a Novel Strategy to Attenuate Cisplatin-induced Nephrotoxicity | ||
Vet Res Copper-mediated MAM regulation of the NF-κB signalling pathway enhances Seneca Valley virus replication in PK-15 cells | ||
Life Sci Metallothionein rescues doxorubicin cardiomyopathy via mitigation of cuproptosis | ||
Int J Mol Sci Transcriptional Responses of Copper-Transport-Related Genes ctr1, ctr2 and atox1 and Their Roles in the Regulation of Cu Homeostasis in Yellow Catfish Pelteobagrus fulvidraco |









