Product Information
83844-4-PBS targets SLC31A1 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species |
Full Name | solute carrier family 31 (copper transporters), member 1 |
Calculated Molecular Weight | 21 kDa |
GenBank Accession Number | BC013611 |
Gene Symbol | SLC31A1 |
Gene ID (NCBI) | 1317 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O15431 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |