SLC33A1 Polyclonal antibody

• 

  WB analysis using 26548-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26548-1-AP (SLC33A1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

SLC33A1 Polyclonal Antibody for WB, ELISA

Cat No. 26548-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ACATN, Acetyl CoA transporter 1, AT 1, AT1, SLC33A1, SPG42

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26548-1-AP targets SLC33A1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24323

  Product name: Recombinant human SLC33A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC014416

  Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS

• Full Name: solute carrier family 33 (acetyl-CoA transporter), member 1
• Calculated Molecular Weight: 549 aa, 61 kDa
• Observed Molecular Weight: 60-62 kDa
• GenBank Accession Number: BC014416
• Gene Symbol: SLC33A1
• Gene ID (NCBI): 9197
• RRID: AB_3085881
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00400
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC33A1 mediates active acetyl-CoA import through the endoplasmic reticulum (ER) membrane into the ER lumen where specific ER-based acetyl-CoA:lysine acetyltransferases are responsible for the acetylation of ER-based protein substrates.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Mujtaba (Verified Customer) (10-14-2025)

The target protein was detected very clearly

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000