Tested Applications
| Positive WB detected in | A431 cells, Caco-2 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32258-1-AP targets SLC35F4 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34518 Product name: Recombinant human SLC35F4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 471-521 aa of NM_001206920 Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA Predict reactive species |
| Full Name | solute carrier family 35, member F4 |
| Calculated Molecular Weight | 521 aa, 58 kDa |
| Observed Molecular Weight | 42 kDa, 65 kDa |
| GenBank Accession Number | NM_001206920 |
| Gene Symbol | SLC35F4 |
| Gene ID (NCBI) | 341880 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | A4IF30 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC35F4 antibody 32258-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



