SLC35F4 Polyclonal antibody

• 

  WB analysis using 32258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32258-1-AP (SLC35F4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 32258-1-AP

  WB result of SLC35F4 antibody (32258-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC35F4 transfected A431 cells.

• Featured Product
• KD/KO Validated

SLC35F4 Polyclonal Antibody for WB, ELISA

Cat No. 32258-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C14orf36

---

Tested Applications

• Positive WB detected in: A431 cells, Caco-2 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32258-1-AP targets SLC35F4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34518

  Product name: Recombinant human SLC35F4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 471-521 aa of NM_001206920

  Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA

• Full Name: solute carrier family 35, member F4
• Calculated Molecular Weight: 521 aa, 58 kDa
• Observed Molecular Weight: 42 kDa, 65 kDa
• GenBank Accession Number: NM_001206920
• Gene Symbol: SLC35F4
• Gene ID (NCBI): 341880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A4IF30
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.