Tested Applications
Positive WB detected in | mouse kidney tissue, MCF-7 cells, rat kidney tissue |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24582-1-AP targets SLC37A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20180 Product name: Recombinant human SLC37A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 247-336 aa of BC152997 Sequence: DVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCL Predict reactive species |
Full Name | solute carrier family 37 (glycerol-3-phosphate transporter), member 1 |
Calculated Molecular Weight | 533 aa, 58 kDa |
Observed Molecular Weight | 60-66 kDa |
GenBank Accession Number | BC152997 |
Gene Symbol | SLC37A1 |
Gene ID (NCBI) | 54020 |
RRID | AB_2879621 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P57057 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC37A1 (also known as SPX1) is one of the SLC37 family members, localized in the endoplasmic reticulum (ER) membrane (PMID:29719821). The SLC37A1 protein also shares 30% sequence identity to GlpT, suggesting that SLC37A1 could be a mammalian glycerol-3-phosphate transporter. The SLC37A1 gene is widely expressed, with the highest transcript levels in adult kidney, bone marrow, intestine, spleen, and liver (PMID:24745989). In addition, the SLC37A1 protein shares 59% homology to SLC37A2, 35% homology to SLC37A3, and 22% homology to SLC37A4 (PMID:23506893). SLC37A1 is a 533 amino-acid protein with a calculated molecular weight of 58 kDa and observed molecular weight 60-66kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC37A1 antibody 24582-1-AP | Download protocol |
IHC protocol for SLC37A1 antibody 24582-1-AP | Download protocol |
IF protocol for SLC37A1 antibody 24582-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |