SLC37A1 Polyclonal antibody

SLC37A1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 24582-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Glycerol 3 phosphate permease, Glucose-6-phosphate exchanger SLC37A1, G3PP, G-3-P permease, G 3 P transporter

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, MCF-7 cells, rat kidney tissue
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24582-1-AP targets SLC37A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20180

Product name: Recombinant human SLC37A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 247-336 aa of BC152997

Sequence: DVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCL

Predict reactive species
Full Name solute carrier family 37 (glycerol-3-phosphate transporter), member 1
Calculated Molecular Weight 533 aa, 58 kDa
Observed Molecular Weight 60-66 kDa
GenBank Accession NumberBC152997
Gene Symbol SLC37A1
Gene ID (NCBI) 54020
RRIDAB_2879621
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP57057
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC37A1 (also known as SPX1) is one of the SLC37 family members, localized in the endoplasmic reticulum (ER) membrane (PMID:29719821). The SLC37A1 protein also shares 30% sequence identity to GlpT, suggesting that SLC37A1 could be a mammalian glycerol-3-phosphate transporter. The SLC37A1 gene is widely expressed, with the highest transcript levels in adult kidney, bone marrow, intestine, spleen, and liver (PMID:24745989). In addition, the SLC37A1 protein shares 59% homology to SLC37A2, 35% homology to SLC37A3, and 22% homology to SLC37A4 (PMID:23506893). SLC37A1 is a 533 amino-acid protein with a calculated molecular weight of 58 kDa and observed molecular weight 60-66kDa.

Protocols

Product Specific Protocols
IF protocol for SLC37A1 antibody 24582-1-APDownload protocol
IHC protocol for SLC37A1 antibody 24582-1-APDownload protocol
WB protocol for SLC37A1 antibody 24582-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...