Recombinant human SLC37A1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag20180
Synonyms
SLC37A1, G 3 P permease, G 3 P transporter, G-3-P permease, G3PP
Validation Data Gallery View All
Product Information
| Peptide Sequence |
DVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCL
(247-336 aa encoded by BC152997) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
