SLC39A3 Polyclonal antibody

• 

  IHC staining of mouse colon using 20458-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 20458-1-AP (SLC39A3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 20458-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 20458-1-AP (SLC39A3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC39A3 Polyclonal Antibody for IHC, ELISA

Cat No. 20458-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

Zinc transporter ZIP3, ZIP 3, ZIP3, ZIP-3, Zrt and Irt like protein 3

---

Tested Applications

• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20458-1-AP targets SLC39A3 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14289

  Product name: Recombinant human SLC39A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-180 aa of BC005869

  Sequence: FMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH

• Full Name: solute carrier family 39 (zinc transporter), member 3
• Calculated Molecular Weight: 314 aa, 34 kDa
• GenBank Accession Number: BC005869
• Gene Symbol: SLC39A3
• Gene ID (NCBI): 29985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRY0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC39A3, also known as ZIP3 (Zrt- and Irt-like protein 3), is a solute carrier family 39 (SLC39) and is critical in maintaining cellular zinc homeostasis (PMID: 32744318). SLC39A3 is a multi-pass membrane protein that belongs to the ZIP family of zinc transporters responsible for the influx of zinc into cells from the extracellular space.