Prostein Polyclonal antibody

• 

  IHC staining of human prostate hyperplasia using 14224-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 14224-1-AP (Prostein antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human prostate hyperplasia using 14224-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 14224-1-AP (Prostein antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human prostate cancer using 14224-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 14224-1-AP (Prostein antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 14224-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 14224-1-AP (Prostein antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Prostein Polyclonal Antibody for IHC, ELISA

Cat No. 14224-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

SLC45A3, PCANAP6, Prostate cancer-associated protein 6, PRST

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue, human prostate hyperplasia tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14224-1-AP targets Prostein in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5463

  Product name: Recombinant human SLC45A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 405-553 aa of BC050416

  Sequence: REKQVFLPKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA

• Full Name: solute carrier family 45, member 3
• Calculated Molecular Weight: 59 kDa
• GenBank Accession Number: BC050416
• Gene Symbol: Prostein
• Gene ID (NCBI): 85414
• RRID: AB_3085433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prostein is a prostate tissue-specific protein whose expression is highly restricted to normal and cancerous prostate tissues. Anti-prostein is useful for the identification of prostate adenocarcinomas and is a good marker to identify prostatic origin in metastatic cancer.