SLC4A3 Polyclonal antibody, PBS Only

• 

  WB analysis using 26883-1-AP (same clone as 26883-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26883-1-AP (SLC4A3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26883-1-PBS in a different storage buffer formulation.

SLC4A3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26883-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

AE 3, AE3, Anion exchange protein 3, Anion exchanger 3, CAE3/BAE3

---

Product Information

26883-1-PBS targets SLC4A3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25457

  Product name: Recombinant human SLC4A3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 429-499 aa of BC146656

  Sequence: NDDKDSGFFPRNPSSSSMNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWPHDPDAKEKPLHMPGGDGHR

• Full Name: solute carrier family 4, anion exchanger, member 3
• Calculated Molecular Weight: 1232 aa, 136 kDa
• Observed Molecular Weight: 135-140 kDa,104 kDa
• GenBank Accession Number: BC146656
• Gene Symbol: SLC4A3
• Gene ID (NCBI): 6508
• RRID: AB_2918114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48751
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.