SLC4A3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC4A3 Polyclonal antibody (26883-1-AP)

SLC4A3 Polyclonal Antibody for WB, ELISA

Cat No. 26883-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

AE 3, AE3, Anion exchange protein 3, Anion exchanger 3, CAE3/BAE3

• 

  WB analysis using 26883-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26883-1-AP (SLC4A3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC4A3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26883-1-AP targets SLC4A3 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25457

  Product name: Recombinant human SLC4A3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 429-499 aa of BC146656

  Sequence: NDDKDSGFFPRNPSSSSMNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWPHDPDAKEKPLHMPGGDGHR

• Full Name: solute carrier family 4, anion exchanger, member 3
• Calculated Molecular Weight: 1232 aa, 136 kDa
• Observed Molecular Weight: 135-140 kDa,104 kDa
• GenBank Accession Number: BC146656
• Gene Symbol: SLC4A3
• Gene ID (NCBI): 6508
• RRID: AB_2918114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48751
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLC4A3 Polyclonal antibody (Cat# 26883-1-AP) has 1 citation. It was used in a Western Blot study published in Molecular Cell (2022), investigating the mTORC1-SLC4A7 axis and its role in stimulating bicarbonate import to enhance de novo nucleotide synthesis. The research falls within the fields of cell metabolism and signaling pathway regulation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; The mTORC1-SLC4A7 axis stimulates bicarbonate import to enhance de novo nucleotide synthesis.; Authors - Eunus S Ali