SLC52A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC52A2 Polyclonal antibody (30396-1-AP)

• 

  IHC staining of human small intestine using 30396-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 30396-1-AP (SLC52A2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 30396-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 30396-1-AP (SLC52A2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC52A2 Polyclonal Antibody for IHC, ELISA

Cat No. 30396-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

GPCR, GPCR41, GPR172A, PAR1, RFT3

---

Tested Applications

• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30396-1-AP targets SLC52A2 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33252

  Product name: Recombinant human GPR172A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-276 aa of BC002917

  Sequence: LLPPPPSVPTGELGSGLQVGAPGAEEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARS

• Full Name: Solute carrier family 52, riboflavin transporter, member 2
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: BC002917
• Gene Symbol: SLC52A2
• Gene ID (NCBI): 79581
• RRID: AB_3742338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAB3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC52A2 (Also known as RFVT2, RFT3) is a membrane protein that belongs to the riboflavin transporter family. SLC52A2 is a transmembrane protein that mediates cellular uptake of riboflavin. Humans are unable to synthesize vitamin B2/riboflavin and must obtain it via intestinal absorption (PubMed:20463145). Mutations in SLC52A2 have been associated with Brown-Vialetto-Van Laere syndrome 2 (BVVLS2) - an autosomal recessive progressive neurologic disorder characterized by deafness, bulbar dysfunction, and axial and limb hypotonia (PMID: 22864630, 23243084).