Tested Applications
Positive WB detected in | C2C12 cells |
Positive IHC detected in | human colon cancer tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
14089-1-AP targets SLC5A11 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5220 Product name: Recombinant human SLC5A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-589 aa of BC057780 Sequence: SWFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAEAIIVSLEENPLVK Predict reactive species |
Full Name | solute carrier family 5 (sodium/glucose cotransporter), member 11 |
Calculated Molecular Weight | 611 aa, 67 kDa |
Observed Molecular Weight | 74 kDa |
GenBank Accession Number | BC057780 |
Gene Symbol | SLC5A11 |
Gene ID (NCBI) | 115584 |
RRID | AB_2189540 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8WWX8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC5A11 (Sodium/myo-inositol cotransporter 2 ), also known as KST1, SMIT2, is a sodium/solute cotransporter-like neuronal protein. In Drosophila, SLC5A11 mediates hunger by regulating potassium channel activity. SLC5A11 has been linked to infantile convulsions and paroxysmal dyskinesia (ICCA syndrome) and benign familial infantile convulsions (BFIC) (PMID: 27397890).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC5A11 antibody 14089-1-AP | Download protocol |
IHC protocol for SLC5A11 antibody 14089-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Clin Endocrinol Metab Placental Inositol Reduced in Gestational Diabetes as Glucose Alters Inositol Transporters and IMPA1 Enzyme Expression. | ||
Front Pharmacol Quercetin Attenuates Atherosclerosis via Modulating Oxidized LDL-Induced Endothelial Cellular Senescence. |