Tested Applications
| Positive WB detected in | mouse testis tissue, mouse stomach tissue, rat stomach tissue |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24324-1-AP targets SLC5A5/Sodium iodide symporter in WB, IHC, IF, IP, ChIP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19504 Product name: Recombinant human SLC5A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 538-643 aa of BC105047 Sequence: TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL Predict reactive species |
| Full Name | solute carrier family 5 (sodium iodide symporter), member 5 |
| Calculated Molecular Weight | 643 aa, 69 kDa |
| Observed Molecular Weight | 50-55 kDa, 75-100 kDa |
| GenBank Accession Number | BC105047 |
| Gene Symbol | Sodium iodide symporter |
| Gene ID (NCBI) | 6528 |
| RRID | AB_2879495 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92911 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The sodium iodide symporter (Na+/I - symporter, NIS), encoded by SLC5A5, is an integral plasma membrane glycoprotein that plays an important role in iodide uptake by thyroid cells. Expression of sodium iodide symporter has also been found in extra-thyroidal tissues, including gastric mucosa, lactating mammary gland and salivary glands. Increased expression of sodium iodide symporter has been found in thyroid tissue from patients with Graves' disease as well as papillary thyroid carcinomas. In addition, sodium iodide symporter was found to express in majority of breast cancer tissue but not in normal tissue. Sodium iodide symporter can be a promising diagnostic and therapeutic tool for thyroid cancer and breast cancer. This antibody recognizes the mature approximately 75-100 kDa protein and a partially glycosylated 50-55 kDa protein. (PMID: 12588808, 9525971)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC5A5/Sodium iodide symporter antibody 24324-1-AP | Download protocol |
| IP protocol for SLC5A5/Sodium iodide symporter antibody 24324-1-AP | Download protocol |
| WB protocol for SLC5A5/Sodium iodide symporter antibody 24324-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC5A5/Sodium iodide symporter Polyclonal antibody (Cat# 24324-1-AP) has 68 citations. These appear in journals including Advanced Science, Cell Death & Differentiation, Cell Death & Disease, Cancer Letters, Clinical Cancer Research, EMBO Journal, Endocrine-Related Cancer, Thyroid, Cancers, Journal of Clinical Endocrinology & Metabolism, PLoS One, and others. Research fields center on thyroid biology and disease—thyroid cancer (papillary, anaplastic), radioiodine uptake and therapy, NIS regulation, endocrine function, and related oncology, toxicology, and immunology studies.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Regeneration of Thyroid Glands in the Spleen Restores Homeostasis in Thyroidectomy Mice | ||
Adv Sci (Weinh) Lipid-Peptide-mRNA Nanoparticles Augment Radioiodine Uptake in Anaplastic Thyroid Cancer | ||
Cell Death Differ REGγ ablation impedes dedifferentiation of anaplastic thyroid carcinoma and accentuates radio-therapeutic response by regulating the Smad7-TGF-β pathway. | ||
Cell Death Differ CRSP8 promotes thyroid cancer progression by antagonizing IKKα-induced cell differentiation. | ||
Cell Death Dis PCSK9 promotes progression of anaplastic thyroid cancer through E-cadherin endocytosis | ||
Cancer Lett Epigenetic inhibition of CTCF by HN1 promotes dedifferentiation and stemness of anaplastic thyroid cancer |
Reviews
What customers say
The single review for this NIS antibody (used at 1:1000 dilution in Western blot and immunofluorescence on thyroid carcinoma cell lines) rates it 5 stars. The reviewer describes it as highly specific with no background bands in Western blot, producing very clear results. They also note good value for money and excellent communication prior to delivery. Overall, the feedback is strongly positive regarding specificity, performance, and service.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Katie (Verified Customer) (08-22-2019) | Highly specific antibody for the sodium iodide symporter (NIS) with no background bands in Western blot, used at 1:1000 dilution. Very clear result. Good value for money, and excellent communication prior to delivery receipt.
|
