Sodium iodide symporter Polyclonal antibody

Sodium iodide symporter Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 24324-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ChIP, ELISA

NIS, Sodium-iodide symporter (Na(+)/I(-) symporter), SLC5A5, Natrium iodide transporter

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, mouse stomach tissue, SGC-7901 cells
Positive IP detected inmouse testis tissue
Positive IHC detected inhuman thyroid cancer tissue, human ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24324-1-AP targets Sodium iodide symporter in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19504

Product name: Recombinant human SLC5A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 538-643 aa of BC105047

Sequence: TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL

Predict reactive species
Full Name solute carrier family 5 (sodium iodide symporter), member 5
Calculated Molecular Weight 643 aa, 69 kDa
Observed Molecular Weight 50-55 kDa, 75-100 kDa
GenBank Accession NumberBC105047
Gene Symbol Sodium iodide symporter
Gene ID (NCBI) 6528
RRIDAB_2879495
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92911
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The sodium iodide symporter (Na+/I - symporter, NIS), encoded by SLC5A5, is an integral plasma membrane glycoprotein that plays an important role in iodide uptake by thyroid cells. Expression of sodium iodide symporter has also been found in extra-thyroidal tissues, including gastric mucosa, lactating mammary gland and salivary glands. Increased expression of sodium iodide symporter has been found in thyroid tissue from patients with Graves' disease as well as papillary thyroid carcinomas. In addition, sodium iodide symporter was found to express in majority of breast cancer tissue but not in normal tissue. Sodium iodide symporter can be a promising diagnostic and therapeutic tool for thyroid cancer and breast cancer. This antibody recognizes the mature approximately 75-100 kDa protein and a partially glycosylated 50-55 kDa protein. (PMID: 12588808, 9525971)

Protocols

Product Specific Protocols
WB protocol for Sodium iodide symporter antibody 24324-1-APDownload protocol
IHC protocol for Sodium iodide symporter antibody 24324-1-APDownload protocol
IP protocol for Sodium iodide symporter antibody 24324-1-APDownload protocol
FC protocol for Sodium iodide symporter antibody 24324-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Adv Sci (Weinh)

Regeneration of Thyroid Glands in the Spleen Restores Homeostasis in Thyroidectomy Mice

Authors - Xue-Jiao Tian
humanWB,IF

Clin Cancer Res

Combined Vorinostat and Chloroquine Inhibit Sodium-Iodide Symporter Endocytosis and Enhance Radionuclide Uptake In Vivo

Authors - Martin L Read
humanWB

Cell Death Differ

REGγ ablation impedes dedifferentiation of anaplastic thyroid carcinoma and accentuates radio-therapeutic response by regulating the Smad7-TGF-β pathway.

Authors - Chan Jiao
humanWB

Cell Death Differ

CRSP8 promotes thyroid cancer progression by antagonizing IKKα-induced cell differentiation.

Authors - Yina Liao
humanWB

Thyroid

Dimerization of the sodium/iodide symporter (NIS).

Authors - Rebecca J Thompson
humanWB

Cell Chem Biol

Targeting non-canonical pathways as a strategy to modulate the sodium iodide symporter.

Authors - Martin L Read

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Katie (Verified Customer) (08-22-2019)

Highly specific antibody for the sodium iodide symporter (NIS) with no background bands in Western blot, used at 1:1000 dilution. Very clear result. Good value for money, and excellent communication prior to delivery receipt.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Thyroid carcinoma cell lines
Loading...