Tested Applications
Positive WB detected in | Caco-2 cells, mouse brain tissue, mouse small intestine tissue, COLO 320 cells, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
26407-1-AP targets SLC5A6 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23907 Product name: Recombinant human SLC5A6 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 551-635 aa of BC012806 Sequence: RMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL Predict reactive species |
Full Name | solute carrier family 5 (sodium-dependent vitamin transporter), member 6 |
Observed Molecular Weight | 69 kDa |
GenBank Accession Number | BC012806 |
Gene Symbol | SLC5A6 |
Gene ID (NCBI) | 8884 |
RRID | AB_2880502 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y289 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC5A6, also known as the sodium-dependent multivitamin transporter (hSMVT), is a transmembrane protein that plays a crucial role in the uptake of essential vitamins, including biotin, pantothenic acid, and lipoic acid. This protein is widely expressed in various human tissues, including the placenta, intestine, brain, liver, lung, kidney, cornea, retina, and heart. It uses energy from the transmembrane sodium ion gradient and membrane potential to actively transport these vitamins into cells. Due to different glycosylation modifications, SLC5A6 may exhibit two bands at ~55 kDa and ~69 kDa. (PMID: 20980265, PMID: 25971966)
Protocols
Product Specific Protocols | |
---|---|
IP protocol for SLC5A6 antibody 26407-1-AP | Download protocol |
WB protocol for SLC5A6 antibody 26407-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Metab Vitamin B5 supports MYC oncogenic metabolism and tumor progression in breast cancer | ||
Mol Cell Proteomics Hypoxia is a dominant remodeler of the effector T cell surface proteome relative to activation and regulatory T cell suppression. |