Product Information
19069-1-AP targets SLC5A9 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13620 Product name: Recombinant human SLC5A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 535-643 aa of BC104863 Sequence: ILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHESTPEISERPAGECPAGGGAAENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKA Predict reactive species |
| Full Name | solute carrier family 5 (sodium/glucose cotransporter), member 9 |
| Calculated Molecular Weight | 681 aa, 74 kDa |
| GenBank Accession Number | BC104863 |
| Gene Symbol | SLC5A9 |
| Gene ID (NCBI) | 200010 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q2M3M2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
