Tested Applications
| Positive WB detected in | mouse heart tissue, HUVEC cells, mouse kidney tissue, rat heart tissue, rat kidney tissue |
| Positive IHC detected in | mouse brain tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20299-1-AP targets SLC6A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14110 Product name: Recombinant human SLC6A8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 541-635 aa of BC012355 Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM Predict reactive species |
| Full Name | solute carrier family 6 (neurotransmitter transporter, creatine), member 8 |
| Calculated Molecular Weight | 635 aa, 71 kDa |
| Observed Molecular Weight | 65-75 kDa |
| GenBank Accession Number | BC012355 |
| Gene Symbol | SLC6A8 |
| Gene ID (NCBI) | 6535 |
| RRID | AB_2878665 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48029 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020). The 75 kDa band is a glycosylated modified form.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC6A8 antibody 20299-1-AP | Download protocol |
| IHC protocol for SLC6A8 antibody 20299-1-AP | Download protocol |
| WB protocol for SLC6A8 antibody 20299-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC6A8 Polyclonal antibody (Cat# 20299-1-AP) has 28 citations published in journals including Cell Metabolism, Nature Communications, Advanced Science, Science Advances, Biomaterials, Acta Biomaterialia, Cancer Immunology Research, and Frontiers in Oncology. Research fields span cancer biology (glioblastoma, lung, liver, pancreatic, and breast cancers), immunotherapy, ferroptosis, creatine metabolism, inflammatory bowel disease, gut microbiota, and cancer cachexia.
| Species | Application | Title |
|---|---|---|
Cell Metab Myeloid cell-derived creatine in the hypoxic niche promotes glioblastoma growth | ||
Cell Metab The gut microbiota alleviates depression by remodeling gut-brain energy metabolism.
| ||
Adv Mater Lysosome Targeted Nanoparticle Aggregation Reverses Immunosuppressive Tumor Microenvironment for Cancer Immunotherapy | ||
Nat Commun Strategically engineered Au(I) complexes for orchestrated tumor eradication via chemo-phototherapy and induced immunogenic cell death | ||
Acta Pharm Sin B Spatial metabolomics highlights metabolic reprogramming in acute myeloid leukemia mice through creatine pathway | ||
Adv Sci (Weinh) Creatine Promotes Endometriosis by Inducing Ferroptosis Resistance via Suppression of PrP |
Reviews
What customers say
The single review for this product is a 5-star rating for Western Blot applications. The reviewer used a 1:500 dilution and tested the antibody on human, pig, and rabbit cell lines, reporting that it works well with porcine and rabbit cell lines. Overall, the feedback is positive, confirming reliable performance across multiple species in WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nusrat (Verified Customer) (12-12-2025) | The Ab works well with porcine and Rb cell lines.
|
