SLC6A8 Polyclonal antibody

• 

  WB analysis using 20299-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20299-1-AP (SLC6A8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HUVEC using 20299-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 20299-1-AP (SLC6A8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 20299-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20299-1-AP (SLC6A8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 20299-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20299-1-AP (SLC6A8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 20299-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20299-1-AP (SLC6A8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 20299-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20299-1-AP (SLC6A8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 20299-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 20299-1-AP (SLC6A8 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SLC6A8 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 20299-1-AP

Publications(19)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Sodium- and chloride-dependent creatine transporter 1, CT1, CRTR, CRT, Creatine transporter 1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HUVEC cells, mouse kidney tissue, rat heart tissue, rat kidney tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 8 publications below
• IF: See 7 publications below

Product Information

20299-1-AP targets SLC6A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14110

  Product name: Recombinant human SLC6A8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 541-635 aa of BC012355

  Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM

• Full Name: solute carrier family 6 (neurotransmitter transporter, creatine), member 8
• Calculated Molecular Weight: 635 aa, 71 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC012355
• Gene Symbol: SLC6A8
• Gene ID (NCBI): 6535
• RRID: AB_2878665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48029
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Sci Adv; Glioblastoma exploits ATP from leading-edge astrocytes to fuel its infiltrative growth revealed by spatially resolved chimeric analysis; Authors - Gaoxia Yang
human	IHC	Front Oncol; Long Non-Coding RNA AL513318.2 as ceRNA Binding to hsa-miR-26a-5p Upregulates SLC6A8 Expression and Predicts Poor Prognosis in Non-Small Lung Cancer.; Authors - Yongfei Fan
mouse	WB	J Agric Food Chem; Artepillin C, a key component of Brazilian propolis, induces thermogenesis in inguinal white adipose tissue of mice through a creatine metabolism-related thermogenic pathway.; Authors - Sho Nishikawa
human	WB,IHC	Ann Transl Med; SLC6A8 is involved in the progression of non-small cell lung cancer through the Notch signaling pathway.; Authors - Yan Feng ; KD Validated
human	IHC	Front Genet; SLC6A8 is a Potential Biomarker for Poor Prognosis in Lung Adenocarcinoma.; Authors - Yongfei Fan
human	WB	Technol Cancer Res Treat; SLC6A8 Knockdown Suppresses the Invasion and Migration of Human Hepatocellular Carcinoma Huh-7 and Hep3B Cells.; Authors - Lu Yuan ; KD Validated