Product Information
82115-2-PBS targets SLC7A11/xCT in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25431 Product name: Recombinant human SLC7A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC012087 Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR Predict reactive species |
| Full Name | solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 |
| Calculated Molecular Weight | 55 kDa |
| GenBank Accession Number | BC012087 |
| Gene Symbol | SLC7A11 |
| Gene ID (NCBI) | 23657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UPY5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer.







