SLC7A11/xCT Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of A549 using 82115-2-RR (same clone as 82115-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using SLC7A11 antibody (82115-2-RR, Clone: 230227C5 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 82115-2-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 82115-2-RR (same clone as 82115-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using SLC7A11 antibody (82115-2-RR, Clone: 230227C5 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 82115-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 82115-2-RR (same clone as 82115-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Anti-Human SLC7A11 (82115-2-RR, Clone:230227C5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 82115-2-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 82115-2-RR (same clone as 82115-2-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug Anti-Human SLC7A11 (82115-2-RR, Clone:230227C5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 82115-2-PBS in a different storage buffer formulation.

SLC7A11/xCT Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82115-2-PBS

Clone No.230227C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

SLC7A11, xCT, 230227C5, Amino acid transport system xc, Amino acid transport system xc-

---

Product Information

82115-2-PBS targets SLC7A11/xCT in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25431

  Product name: Recombinant human SLC7A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-42 aa of BC012087

  Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR

• Full Name: solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
• Calculated Molecular Weight: 55 kDa
• GenBank Accession Number: BC012087
• Gene Symbol: SLC7A11
• Gene ID (NCBI): 23657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UPY5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer.