Tested Applications
| Positive WB detected in | unboiled HeLa cells, unboiled HepG2 cells, unboiled mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
32384-1-AP targets SLC7A11/xCT in WB, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38215 Product name: Recombinant mouse Slc7a11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-42 aa of NM_011990 Sequence: MVRKPVVATISKGGYLQGNMSGRLPSMGDQEPPGQEKVVLKK Predict reactive species |
| Full Name | solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | NM_011990 |
| Gene Symbol | Slc7a11 |
| Gene ID (NCBI) | 26570 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9WTR6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC7A11 (also known as xCT) is a membrane transporter involved in cysteine uptake. It promotes glutathione synthesis through cystine uptake and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers, including lung cancer. 32384-1-AP recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC7A11/xCT antibody 32384-1-AP | Download protocol |
| WB protocol for SLC7A11/xCT antibody 32384-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

