CoraLite® Plus 488-conjugated SLC7A11/xCT Recombinant monoclonal antibody

SLC7A11/xCT Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82115-2
Clone No.230227C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

SLC7A11, xCT, 230227C5, Amino acid transport system xc, Amino acid transport system xc-

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells, A549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82115-2 targets SLC7A11/xCT in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25431

Product name: Recombinant human SLC7A11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-42 aa of BC012087

Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR

Predict reactive species
Full Name solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
Calculated Molecular Weight 55 kDa
GenBank Accession NumberBC012087
Gene Symbol SLC7A11
Gene ID (NCBI) 23657
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UPY5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer.

Loading...
||
New chat Able
正在加载,请稍候...