Tested Applications
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-82115-2 targets SLC7A11/xCT in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25431 Product name: Recombinant human SLC7A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC012087 Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR Predict reactive species |
| Full Name | solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 |
| Calculated Molecular Weight | 55 kDa |
| GenBank Accession Number | BC012087 |
| Gene Symbol | SLC7A11 |
| Gene ID (NCBI) | 23657 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UPY5 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer.





