SLC7A2 Polyclonal antibody, PBS Only

• 

  WB analysis using 30232-1-AP (same clone as 30232-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30232-1-AP (SLC7A2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30232-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 30232-1-AP (same clone as 30232-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30232-1-AP (SLC7A2 antibody) at dilution of 1:160 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30232-1-PBS in a different storage buffer formulation.

SLC7A2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30232-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HCAT2, Cationic amino acid transporter 2, CAT-2

---

Product Information

30232-1-PBS targets SLC7A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31207

  Product name: Recombinant human SLC7A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 568-657 aa of BC104905

  Sequence: ILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHEKTSEF

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 2
• Calculated Molecular Weight: 698 aa, 76 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC104905
• Gene Symbol: SLC7A2
• Gene ID (NCBI): 6542
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52569
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Solute carrier family 7 member 2 (SLC7A2), also known as CAT2, is a member of the solute carrier superfamily. It functions as a cationic amino acid transporter, which can transport cationic amino acids (arginine, lysine and ornithine) into the cytosol and regulate inflammation (PMID: 35152203). It has been shown that lower SLC7A2 expression is associated with worse prognosis of ovarian cancer and hepatocellular carcinoma (PMID: 34108444; 32647070), and SLC7A2 deficiency in inflammatory bowel tissues increases the risk of inflammation-associated colon tumorigenesis (PMID: 30202097)