SLC7A2 Polyclonal antibody

• 

  WB analysis using 30232-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30232-1-AP (SLC7A2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 30232-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30232-1-AP (SLC7A2 antibody) at dilution of 1:160 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC7A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30232-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CAT-2, Cationic amino acid transporter 2, HCAT2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30232-1-AP targets SLC7A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31207

  Product name: Recombinant human SLC7A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 568-657 aa of BC104905

  Sequence: ILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHEKTSEF

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 2
• Calculated Molecular Weight: 698 aa, 76 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC104905
• Gene Symbol: SLC7A2
• Gene ID (NCBI): 6542
• RRID: AB_3086271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52569
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 7 member 2 (SLC7A2), also known as CAT2, is a member of the solute carrier superfamily. It functions as a cationic amino acid transporter, which can transport cationic amino acids (arginine, lysine and ornithine) into the cytosol and regulate inflammation (PMID: 35152203). It has been shown that lower SLC7A2 expression is associated with worse prognosis of ovarian cancer and hepatocellular carcinoma (PMID: 34108444; 32647070), and SLC7A2 deficiency in inflammatory bowel tissues increases the risk of inflammation-associated colon tumorigenesis (PMID: 30202097)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; Gut bacterial L-lysine alters metabolism and histone methylation to drive dendritic cell tolerance; Authors - Qiang Tang