Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27183-1-AP targets SLC7A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25494 Product name: Recombinant human SLC7A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 433-506 aa of BC033816 Sequence: DQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVCSSLLAVLLTALCLVLAQWSVPLLSGD Predict reactive species |
| Full Name | solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 |
| Calculated Molecular Weight | 67 kDa |
| Observed Molecular Weight | 62-70 kDa |
| GenBank Accession Number | BC033816 |
| Gene Symbol | SLC7A3 |
| Gene ID (NCBI) | 84889 |
| RRID | AB_3665521 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WY07 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC7A3 (solute carrier family 7 member 3), also called CAT-3, is a sodium-independent transporter selective for cationic amino acids, especially arginine. Highest mRNA levels are found in thymus, testis and placenta, with distinct expression in thalamus/hippocampus of adult brain. By governing intracellular arginine, SLC7A3 modulates nitric-oxide synthesis and mTOR signalling, processes critical for immunity, neurotransmission and vascular tone.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC7A3 antibody 27183-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

