SLC7A3 Polyclonal antibody, PBS Only

• 

  WB analysis using 27183-1-AP (same clone as 27183-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27183-1-AP (SLC7A3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27183-1-PBS in a different storage buffer formulation.

SLC7A3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27183-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ATRC3, CAT 3, CAT3

---

Product Information

27183-1-PBS targets SLC7A3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25494

  Product name: Recombinant human SLC7A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 433-506 aa of BC033816

  Sequence: DQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVCSSLLAVLLTALCLVLAQWSVPLLSGD

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 3
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 62-70 kDa
• GenBank Accession Number: BC033816
• Gene Symbol: SLC7A3
• Gene ID (NCBI): 84889
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WY07
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC7A3 (solute carrier family 7 member 3), also called CAT-3, is a sodium-independent transporter selective for cationic amino acids, especially arginine. Highest mRNA levels are found in thymus, testis and placenta, with distinct expression in thalamus/hippocampus of adult brain. By governing intracellular arginine, SLC7A3 modulates nitric-oxide synthesis and mTOR signalling, processes critical for immunity, neurotransmission and vascular tone.