Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SLC7A5 Polyclonal antibody

SLC7A5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28670-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ChIP, ELISA

LAT1, 4F2 LC, 4F2 light chain, 4F2LC, CD98 light chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, MCF-7 cells, HeLa cells, HepG2 cells, MKN-45 cells, SW480 cells
Positive IHC detected inhuman stomach cancer tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHT-29 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28670-1-AP targets SLC7A5 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29164

Product name: Recombinant human SLC7A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-58 aa of BC039692

Sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI

Predict reactive species
Full Name solute carrier family 7 (cationic amino acid transporter, y+ system), member 5
Calculated Molecular Weight 507 aa, 55 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberBC039692
Gene Symbol SLC7A5
Gene ID (NCBI) 8140
RRIDAB_2918188
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01650
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)

Protocols

Product Specific Protocols
IF protocol for SLC7A5 antibody 28670-1-APDownload protocol
IHC protocol for SLC7A5 antibody 28670-1-APDownload protocol
WB protocol for SLC7A5 antibody 28670-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB,IHC

Eur J Nucl Med Mol Imaging

Synthesis, preclinical assessment, and first-in-human study of [18F]d4-FET for brain tumor imaging

Authors - Lu Hou
humanWB

Mol Metab

RNA-binding protein YBX3 promotes PPARγ-SLC3A2 mediated BCAA metabolism fueling brown adipogenesis and thermogenesis

Authors - Lin-Yun Chen
WB

J Inherit Metab Dis

Metabolic characterization of neurogenetic disorders involving glutamatergic neurotransmission

Authors - Sofía Illescas
humanWB

Oncol Lett

SLC7A5 regulates tryptophan uptake and PD‑L1 expression levels via the kynurenine pathway in ovarian cancer

Authors - Ruibin Jiang
humanWB

J Exp Clin Cancer Res

CircARID1A binds to IGF2BP3 in gastric cancer and promotes cancer proliferation by forming a circARID1A-IGF2BP3-SLC7A5 RNA-protein ternary complex

Authors - Qiang Ma
IHC

PLoS One

Identification of differentially expressed genes associated with ferroptosis in ulcerative colitis

Authors - Fang Zhang

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ewan (Verified Customer) (07-22-2026)

Excellent works well in 5% milk PBS-T

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: SUM159 / SUM149

Xie (Verified Customer) (07-07-2023)

The expression of Slc7a5 is good for my samples

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: brain
SLC7A5 Antibody Immunofluorescence validation (1:250 dilution) in brain (Cat no:28670-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...