Tested Applications
| Positive WB detected in | A549 cells, MCF-7 cells, HeLa cells, HepG2 cells, MKN-45 cells, SW480 cells |
| Positive IHC detected in | human stomach cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HT-29 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 15 publications below |
| IHC | See 4 publications below |
Product Information
28670-1-AP targets SLC7A5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29164 Product name: Recombinant human SLC7A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-58 aa of BC039692 Sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI Predict reactive species |
| Full Name | solute carrier family 7 (cationic amino acid transporter, y+ system), member 5 |
| Calculated Molecular Weight | 507 aa, 55 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC039692 |
| Gene Symbol | SLC7A5 |
| Gene ID (NCBI) | 8140 |
| RRID | AB_2918188 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01650 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC7A5 antibody 28670-1-AP | Download protocol |
| IHC protocol for SLC7A5 antibody 28670-1-AP | Download protocol |
| WB protocol for SLC7A5 antibody 28670-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Eur J Nucl Med Mol Imaging Synthesis, preclinical assessment, and first-in-human study of [18F]d4-FET for brain tumor imaging | ||
Mol Metab RNA-binding protein YBX3 promotes PPARγ-SLC3A2 mediated BCAA metabolism fueling brown adipogenesis and thermogenesis | ||
J Inherit Metab Dis Metabolic characterization of neurogenetic disorders involving glutamatergic neurotransmission | ||
Oncol Lett SLC7A5 regulates tryptophan uptake and PD‑L1 expression levels via the kynurenine pathway in ovarian cancer | ||
J Exp Clin Cancer Res CircARID1A binds to IGF2BP3 in gastric cancer and promotes cancer proliferation by forming a circARID1A-IGF2BP3-SLC7A5 RNA-protein ternary complex | ||
Cell Death Dis Effects of methionine deficiency on B7H3-DAP12-CAR-T cells in the treatment of lung squamous cell carcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xie (Verified Customer) (07-07-2023) | The expression of Slc7a5 is good for my samples
![]() |
























