Tested Applications
| Positive IHC detected in | rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31437-1-AP targets SLC8A2 in IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34438 Product name: Recombinant human SLC8A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-68 aa of NM_015063 Sequence: AATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDK Predict reactive species |
| Full Name | solute carrier family 8 (sodium/calcium exchanger), member 2 |
| Calculated Molecular Weight | 921 aa, 100 kDa |
| GenBank Accession Number | NM_015063 |
| Gene Symbol | SLC8A2 |
| Gene ID (NCBI) | 6543 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9UPR5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC8A2, or solute carrier family 8 member 2, belongs to the SLC8 gene family, which encodes sodium-calcium exchangers (NCX). These proteins are part of the CaCA (Ca2+/Cation Antiporter) superfamily and play a significant role in regulating Ca2+-dependent events in many cell types. SLC8A2 has been implicated in various diseases, such as heart failure, arrhythmia, cerebral ischemia, hypertension, diabetes, and muscle dystrophy.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC8A2 antibody 31437-1-AP | Download protocol |
| IHC protocol for SLC8A2 antibody 31437-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





