SLC9A9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC9A9 Polyclonal antibody (13718-1-AP)

SLC9A9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13718-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

NHE-9, NHE9, NHE 9, Nbla00118, Na(+)/H(+) exchanger 9

• 

  WB analysis of Raji using 13718-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 13718-1-AP (SLC9A9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13718-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13718-1-AP (SLC9A9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 13718-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 13718-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 13718-1-AP (SLC9A9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC9A9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human tonsillitis tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:600
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13718-1-AP targets SLC9A9 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4660

  Product name: Recombinant human SLC9A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 481-645 aa of BC035779

  Sequence: TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN

• Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 9
• Calculated Molecular Weight: 645 aa, 73 kDa
• Observed Molecular Weight: 66-73 kDa
• GenBank Accession Number: BC035779
• Gene Symbol: SLC9A9
• Gene ID (NCBI): 285195
• RRID: AB_2189452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLC9A9 polyclonal antibody (Cat# 13718-1-AP) has 5 citations published in Cell Communication and Signaling, Cancer Cell International, Molecular Cancer Research, American Journal of Medical Genetics B, and Attention Deficit and Hyperactivity Disorders. The research fields span glioblastoma, colorectal cancer, tumor progression, autism spectrum disorder, and ADHD, with applications including WB, IHC, and CoIP in human samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Commun Signal; MicroRNA-135a regulates NHE9 to inhibit proliferation and migration of glioblastoma cells.; Authors - Daniela M Gomez Zubieta
human	IHC	Cancer Cell Int; SLC9A9 links tumor immune infiltration to therapeutic response in colorectal cancer with emphasis on mismatch repair proficient subtype.; Authors - Yu-cheng Xu
human	WB	Mol Cancer Res; An Endosomal Acid-Regulatory Feedback System Rewires Cytosolic cAMP Metabolism and Drives Tumor Progression; Authors - Hari Prasad
human	WB	Am J Med Genet B Neuropsychiatr Genet; Autism spectrum disorder traits in Slc9a9 knock-out mice.; Authors - Lina Yang
human	WB, CoIP	Atten Defic Hyperact Disord; Effect of disease-associated SLC9A9 mutations on protein-protein interaction networks: implications for molecular mechanisms for ADHD and autism.; Authors - Yanli Zhang-James