SLC9A9 Polyclonal antibody

• 

  WB analysis of Raji using 13718-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 13718-1-AP (SLC9A9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13718-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13718-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13718-1-AP (SLC9A9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 13718-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13718-1-AP (SLC9A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 13718-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 13718-1-AP (SLC9A9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

SLC9A9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13718-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

NHE-9, NHE9, NHE 9, Nbla00118, Na(+)/H(+) exchanger 9

---

Tested Applications

• Positive WB detected in: Raji cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human tonsillitis tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:600
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• CoIP: See 1 publications below

Product Information

13718-1-AP targets SLC9A9 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4660

  Product name: Recombinant human SLC9A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 481-645 aa of BC035779

  Sequence: TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN

• Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 9
• Calculated Molecular Weight: 645 aa, 73 kDa
• Observed Molecular Weight: 66-73 kDa
• GenBank Accession Number: BC035779
• Gene Symbol: SLC9A9
• Gene ID (NCBI): 285195
• RRID: AB_2189452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Commun Signal; MicroRNA-135a regulates NHE9 to inhibit proliferation and migration of glioblastoma cells.; Authors - Daniela M Gomez Zubieta
human	WB	Am J Med Genet B Neuropsychiatr Genet; Autism spectrum disorder traits in Slc9a9 knock-out mice.; Authors - Lina Yang
human	WB, CoIP	Atten Defic Hyperact Disord; Effect of disease-associated SLC9A9 mutations on protein-protein interaction networks: implications for molecular mechanisms for ADHD and autism.; Authors - Yanli Zhang-James
human	WB	Mol Cancer Res; An Endosomal Acid-Regulatory Feedback System Rewires Cytosolic cAMP Metabolism and Drives Tumor Progression; Authors - Hari Prasad