SLCO4C1 Polyclonal antibody

• 

  WB analysis using 24584-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24584-1-AP (SLCO4C1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 24584-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24584-1-AP (SLCO4C1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 24584-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24584-1-AP (SLCO4C1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SLCO4C1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24584-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

OATP H, OATP M1, OATP4C1, OATPX, Organic anion transporter M1, PRO2176, SLC21A20, SLCO4C1

---

Tested Applications

• Positive WB detected in: human plasma, mouse kidney tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

24584-1-AP targets SLCO4C1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20177

  Product name: Recombinant human SLCO4C1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC152989

  Sequence: MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG

• Full Name: solute carrier organic anion transporter family, member 4C1
• Calculated Molecular Weight: 724 aa, 79 kDa
• Observed Molecular Weight: 60-85 kDa
• GenBank Accession Number: BC152989
• Gene Symbol: SLCO4C1
• Gene ID (NCBI): 353189
• RRID: AB_2879622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZQN7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLCO4C1 is the only OATP ( organic anion transporting polypeptide) expressed at the human kidney's basolateral side of proximal tubular cells and mediates the excretion of uremic toxins (PMID: 21656517).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Ethnopharmacol; Banxia Baizhu Tianma decoction attenuates obesity-related hypertension.; Authors - Yue-Hua Jiang
human	WB	Oncol Rep; Knockdown of SLCO4C1 inhibits cell proliferation and metastasis in endometrial cancer through inactivating the PI3K/Akt signaling pathway.; Authors - Xiang Hu ; KD Validated
mouse	WB	Biochem Biophys Res Commun; PMID: 31540689; Authors - Yuki Kanado
rat	WB	World J Gastrointest Pathophysiol; Evaluating the regulation of transporter proteins and P-glycoprotein in rats with cholestasis and its implication for digoxin clearance.; Authors - Parker Giroux
human	IHC	Front Cell Dev Biol; Identification and verification of a prognostic signature based on a miRNA-mRNA interaction pattern in colon adenocarcinoma; Authors - Qiwu Zhao
human	WB	Aging (Albany NY); Identification and validation of SLCO4C1 as a biological marker in hepatocellular carcinoma based on anoikis classification features; Authors - Tianbing Wang