OATP5A1/SLCO5A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OATP5A1/SLCO5A1 Polyclonal antibody (25744-1-AP)

OATP5A1/SLCO5A1 Polyclonal Antibody for WB, ELISA

Cat No. 25744-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SLCO5A1, OATP J, OATP RP4, OATP5A1, OATPJ

• 

  WB analysis using 25744-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25744-1-AP (SLCO5A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25744-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25744-1-AP (SLCO5A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OATP5A1/SLCO5A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: DU 145 cells, mouse brain tissue, PC-3 cells, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25744-1-AP targets OATP5A1/SLCO5A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22620

  Product name: Recombinant human SLCO5A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-128 aa of BC137424

  Sequence: MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR

• Full Name: solute carrier organic anion transporter family, member 5A1
• Observed Molecular Weight: 110-12 kDa
• GenBank Accession Number: BC137424
• Gene Symbol: SLCO5A1
• Gene ID (NCBI): 81796
• RRID: AB_3742158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2Y9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLCO5A1 encodes a solute carrier organic anion transporter that mediates sodium-independent organic anion transmembrane transport. It is a member of the SLCO family of organic anion transporting polypeptides and is positioned at the plasma membrane, basolateral plasma membrane, and intracellular membrane-bounded organelle membranes.

Publications

What published studies show

The OATP5A1/SLCO5A1 Polyclonal antibody (Cat# 25744-1-AP) has 1 citation to date. The citation appears in Acta Pharmacologica Sinica (Impact Factor 10.4), published in 2026. The study investigates the solute carrier transporter SLCO5A1 as a novel therapeutic target for myocardial infarction-induced heart failure, utilizing the antibody for Western blot analysis in mouse samples. The associated research field is cardiovascular pharmacology and heart failure therapeutics.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Acta Pharmacol Sin; The solute carrier transporter SLCO5A1 as a novel therapeutic target for the treatment of myocardial infarction-induced heart failure.; Authors - Ke-Yu Liu