Tested Applications
| Positive WB detected in | DU 145 cells, mouse brain tissue, PC-3 cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25744-1-AP targets OATP5A1/SLCO5A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22620 Product name: Recombinant human SLCO5A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-128 aa of BC137424 Sequence: MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR Predict reactive species |
| Full Name | solute carrier organic anion transporter family, member 5A1 |
| Observed Molecular Weight | 110-12 kDa |
| GenBank Accession Number | BC137424 |
| Gene Symbol | SLCO5A1 |
| Gene ID (NCBI) | 81796 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H2Y9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for OATP5A1/SLCO5A1 antibody 25744-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



