Product Information
11078-1-PBS targets SLCO6A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1532 Product name: Recombinant human SLCO6A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 570-657 aa of BC034976 Sequence: PSIFKMSGETSCILRDVNKCGHTGRCWIYNKTKMAFLLVGICFLCKLCTIIFTTIAFFIYKRRLNENTDFPDVTVKNPKVKKKEETDL Predict reactive species |
| Full Name | solute carrier organic anion transporter family, member 6A1 |
| Calculated Molecular Weight | 719aa,79 kDa; 657aa,73 kDa |
| Observed Molecular Weight | 73-80 kDa, 51 kDa |
| GenBank Accession Number | BC034976 |
| Gene Symbol | SLCO6A1 |
| Gene ID (NCBI) | 133482 |
| RRID | AB_2189858 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86UG4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLCO6A1, also named as OATP6A1 and SLC21A19, belongs to the organic anion transporter protein (OATPs) family. OATP proteins are reported to mediate the transport of a variety of low molecular weight substrates, such as drugs, toxins and steroid hormone conjugates. SLCO6A1 is strongly expressed in testis and weakly expressed in spleen, brain, fetal brain and placenta. SLCO6A1 has 3 isoforms with the molecular mass of 51, 73 and 79 kDa. (PMID: 26861727)

