Tested Applications
Positive WB detected in | DU 145 cells, HEK-293 cells, Jurkat cells |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
26060-1-AP targets SLFN11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22030 Product name: Recombinant human SLFN11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 735-796 aa of BC052586 Sequence: DPIAKYLQKEMQVIRSNPSFNIPTGCLEVFPEAEWSQGVQGTLRIKKYLTVEQIMTCVADTC Predict reactive species |
Full Name | schlafen family member 11 |
Calculated Molecular Weight | 901 aa, 103 kDa |
Observed Molecular Weight | 103 kDa |
GenBank Accession Number | BC052586 |
Gene Symbol | SLFN11 |
Gene ID (NCBI) | 91607 |
RRID | AB_2880356 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q7Z7L1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for SLFN11 antibody 26060-1-AP | Download protocol |
IHC protocol for SLFN11 antibody 26060-1-AP | Download protocol |
IP protocol for SLFN11 antibody 26060-1-AP | Download protocol |
WB protocol for SLFN11 antibody 26060-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |