Tested Applications
| Positive WB detected in | DU 145 cells, HEK-293 cells, Jurkat cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26060-1-AP targets SLFN11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22030 Product name: Recombinant human SLFN11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 735-796 aa of BC052586 Sequence: DPIAKYLQKEMQVIRSNPSFNIPTGCLEVFPEAEWSQGVQGTLRIKKYLTVEQIMTCVADTC Predict reactive species |
| Full Name | schlafen family member 11 |
| Calculated Molecular Weight | 901 aa, 103 kDa |
| Observed Molecular Weight | 103 kDa |
| GenBank Accession Number | BC052586 |
| Gene Symbol | SLFN11 |
| Gene ID (NCBI) | 91607 |
| RRID | AB_2880356 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z7L1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLFN11 antibody 26060-1-AP | Download protocol |
| IHC protocol for SLFN11 antibody 26060-1-AP | Download protocol |
| IP protocol for SLFN11 antibody 26060-1-AP | Download protocol |
| WB protocol for SLFN11 antibody 26060-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







