SLITRK6 Polyclonal antibody, PBS Only

• 

  WB analysis using 21150-1-AP (same clone as 21150-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21150-1-AP (SLITRK6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21150-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 21150-1-AP (same clone as 21150-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21150-1-AP (SLITRK6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21150-1-PBS in a different storage buffer formulation.

SLITRK6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21150-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

SLIT and NTRK like protein 6, SLIT and NTRK-like protein 6

---

Product Information

21150-1-PBS targets SLITRK6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15701

  Product name: Recombinant human SLITRK6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 621-816 aa of BC101070

  Sequence: IVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQT

• Full Name: SLIT and NTRK-like family, member 6
• Calculated Molecular Weight: 841 aa, 95 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC101070
• Gene Symbol: SLITRK6
• Gene ID (NCBI): 84189
• RRID: AB_10732812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5Y7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLITRK6 is a member of the SLITRK family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin receptors. This protein functions as a regulator of neurite outgrowth required for normal hearing and vision. Mutations in SLITRK6 gene are a cause of myopia and deafness.