Tested Applications
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18395-1-AP targets SLN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | squirrel |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13176 Product name: Recombinant human SLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-31 aa of BC005261 Sequence: MGINTRELFLNFTIVLITVILMWLLVRSYQY Predict reactive species |
| Full Name | sarcolipin |
| Calculated Molecular Weight | 31 aa, 4 kDa |
| GenBank Accession Number | BC005261 |
| Gene Symbol | SLN |
| Gene ID (NCBI) | 6588 |
| RRID | AB_2286622 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00631 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLN, also named as Sarcolipin, belongs to the sarcolipin family. It is associated with calcium ATPase SERCA1. It inhibits SERCA pumps. SLN, a key regulator of cardiac sarco(endo)plasmic reticulum (SR) Ca(2+) ATPase, is predominantly expressed in atria and mediates β-adrenergic responses. SLN can self-assembly to dimer and oligomer for playing importantphysiological function.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLN antibody 18395-1-AP | Download protocol |
| IHC protocol for SLN antibody 18395-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLN (sarcolipin) Polyclonal antibody, catalog number 18395-1-AP, has 14 total citations. These appear in journals including Advanced Science, EBioMedicine, Journal of Hazardous Materials, Journal of Endocrinology, Journal of Biological Chemistry, Scientific Reports, Frontiers in Physiology, Skeletal Muscle, Experimental Cell Research, Veterinary Science, Comparative Biochemistry and Physiology B, and Journal of Developmental Origins of Health and Disease. Research fields center on skeletal muscle physiology, calcium signaling, thermogenesis, and muscle-related metabolic and disease processes.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) HUWE1 in Skeletal Muscle Prevents Muscle Fatigue via Maintaining Iron and Calcium Homeostasis. | ||
EBioMedicine Maternal exercise intergenerationally drives muscle-based thermogenesis via activation of apelin-AMPK signaling. | ||
J Hazard Mater Extractable organic matter from PM2.5 inhibits cardiomyocyte differentiation via AHR-mediated m6A RNA methylation | ||
J Physiol Biochem Sarcolipin expression is repressed by endoplasmic reticulum stress in C2C12 myotubes. | ||
Sci Rep Skeletal muscle overexpression of sAnk1.5 in transgenic mice does not predispose to type 2 diabetes |
