SLN Polyclonal antibody, PBS Only

• 

  IHC staining of human heart using 18395-1-AP (same clone as 18395-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18395-1-AP (SLN Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18395-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18395-1-AP (same clone as 18395-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18395-1-AP (SLN Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18395-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 18395-1-AP (same clone as 18395-1-PBS)

  Immunofluorescent analysis of PC-3 cells using 18395-1-AP (SLN antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18395-1-PBS in a different storage buffer formulation.

SLN Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 18395-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

18395-1-PBS targets SLN in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13176

  Product name: Recombinant human SLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-31 aa of BC005261

  Sequence: MGINTRELFLNFTIVLITVILMWLLVRSYQY

• Full Name: sarcolipin
• Calculated Molecular Weight: 31 aa, 4 kDa
• GenBank Accession Number: BC005261
• Gene Symbol: SLN
• Gene ID (NCBI): 6588
• RRID: AB_2286622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00631
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLN, also named as Sarcolipin, belongs to the sarcolipin family. It is associated with calcium ATPase SERCA1. It inhibits SERCA pumps. SLN, a key regulator of cardiac sarco(endo)plasmic reticulum (SR) Ca(2+) ATPase, is predominantly expressed in atria and mediates β-adrenergic responses. SLN can self-assembly to dimer and oligomer for playing importantphysiological function.