Product Information
18395-1-PBS targets SLN in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13176 Product name: Recombinant human SLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-31 aa of BC005261 Sequence: MGINTRELFLNFTIVLITVILMWLLVRSYQY Predict reactive species |
| Full Name | sarcolipin |
| Calculated Molecular Weight | 31 aa, 4 kDa |
| GenBank Accession Number | BC005261 |
| Gene Symbol | SLN |
| Gene ID (NCBI) | 6588 |
| RRID | AB_2286622 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00631 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLN, also named as Sarcolipin, belongs to the sarcolipin family. It is associated with calcium ATPase SERCA1. It inhibits SERCA pumps. SLN, a key regulator of cardiac sarco(endo)plasmic reticulum (SR) Ca(2+) ATPase, is predominantly expressed in atria and mediates β-adrenergic responses. SLN can self-assembly to dimer and oligomer for playing importantphysiological function.





