SLPI Polyclonal antibody

SLPI Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 32205-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

ALK1, ALP, Antileukoprotease, Antileukoproteinase, HUSI-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human saliva
Positive IP detected inHeLa cells, human saliva
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

32205-1-AP targets SLPI in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag36523

Product name: Recombinant human SLPI protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 26-88 aa of BC020708

Sequence: SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGK

Predict reactive species
Full Name secretory leukocyte peptidase inhibitor
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC020708
Gene Symbol SLPI
Gene ID (NCBI) 6590
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP03973
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Secretory leukocyte protease inhibitor (SLPI) is also named as Antileukoproteinase (ALP), BLPI, HUSI-1, WAP4, WFDC4 and mucus proteinase inhibitor (MPI). The SLPI is a multifunctional protein involved in the modulation of immunological response and the inhibition of protease activities. SLPI acts as an inhibitor of proteases, exerts antibacterial properties, and suppresses the transcription of proinflammatory genes through the nuclear factor-kappa B (NF-κB) pathway (PMID: 37356220). SLPI is as a serine protease inhibitor and also as a critical mediator that is involved in the PTH-mediated shift to the osteoblastic phase (PMID: 17474882). Slpi induction in osteoblasts enhances its differentiation, and increases osteoblast-osteoclast contact, thereby suppressing osteoclastic function (PMID: 17474882). SLPI is an evolutionarily conserved, pleiotropic protein expressed at mucosal surfaces, mainly by epithelial cells (PMID: 33602652). SLPI maintains homeostasis at barrier tissues by preventing tissue destruction and regulating the threshold of inflammatory immune responses, while protecting the host from infection. However, as recent studies demonstrate that overexpression of SLPI increases the metastatic potential of epithelial tumors (PMID: 33602652). The role of this protein as a regulatory agent has been implicated in various types of cancer (PMID: 37356220).

Protocols

Product Specific Protocols
IF protocol for SLPI antibody 32205-1-APDownload protocol
IP protocol for SLPI antibody 32205-1-APDownload protocol
WB protocol for SLPI antibody 32205-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...